FGF-basic, Fibroblast Growth Factor-basic, human

£114.00 exc. VAT

SKU: RC215-13.SIZE.10ug Category:

10ug

FGF-basic, Fibroblast Growth Factor-basic, human: Human Fibroblast Growth Factor-basic
FGF basic (FGF-2, HBGF-2) is one of at least 22 mitogenic proteins of the FGF family, which show 35 – 60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted. Transcription from alternate start sites produces 21 – 24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH-3T3 cells.
Recombinant Human Fibroblast Growth Factor-basic (rHuFGF-2 )
Source: Escherichia coli.
Molecular Weight:
Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 155 amino acids.
Quantity: 10ug/50ug/1000µg
Purity: >96% by SDS-PAGE and HPLC analyses.
Biological Activity: Fully biologically active when compared to standard. The ED50, calculated by the dose- dependant proliferation of BAF3 cells expressing FGF receptors (measured by 3H- thymidine uptake) is <0.5 ng/ml, corresponding to a specific activity of 2.0 x 10^6 Units/mg. Formulation: Lyophilized from a 0.2mm filtered concentrated (1mg/ml) solution in PBS, pH 7.4. AA Sequence: MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVV SIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSK TGPGQKAILFLPMSAKS Endotoxin level: Less than 1EU/mg of rHubFGF as determined by LAL method. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Accession number: NM_002006, UnitProt ID: P09038

CAS
Grade
HS Code

2937.19.0000

Manufacturer

Bio Basic

Pack Size

10ug

Shipping Conditions

ICE

Sterile

yes

Storage Conditions

(-15 to -20)C

UNSPSC Category

Other Cytokines and Chemokines

UNSPSC Code

41116127

DG
Hazard Class
Hazard UN
Shopping Basket